- beta-1,4-Galactosyltransferase 1/B4GalT1 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-88655
- Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- Rabbit
- This antibody was developed against Recombinant Protein corresponding to amino acids: FRGMSISRPN AVVGRCRMIR HSRDKKNEPN PQRFDRIAHT KETMLSDGLN SLTYQVLDVQ RYPLYTQITV DIGTPS
- PBS (pH 7.2) and 40% Glycerol
- B4GAL-T1, CDG2D, CLDLFIB, GGTB2, GT1, GTB, beta4Gal-T1
- beta-1,4-Galactosyltransferase 1/B4GalT1
- Human
- Unconjugated
- 0.1 ml (also 25ul)
- beta-1,4-galactosyltransferase 1
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Lipid and Metabolism
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
FRGMSISRPNAVVGRCRMIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYQVLDVQRYPLYTQITVDIGTPS
Specifications/Features
Available conjugates: Unconjugated